Lineage for d1nrca_ (1nrc A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) 
Protein Splicesomal U1A protein [54932] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries) 
Domain d1nrca_: 1nrc A: [39160]
Details for d1nrca_
PDB Entry: 1nrc (more details), 2.8 Å
PDB Description: crystal structure of the rna-binding domain of the u1 small nuclear ribonucleoprotein a
SCOP Domain Sequences for d1nrca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrca_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens)}
trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
tnalrsmqgfpfydkpmricyaktd
SCOP Domain Coordinates for d1nrca_:
Click to download the PDB-style file with coordinates for d1nrca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nrca_:
- d1nrca_ first appeared (with stable ids) in SCOP 1.55
- d1nrca_ appears in SCOP 1.59
- d1nrca_ last appears in SCOP 1.63
View in 3D
