SCOPe 2.07: Domain d6sm7c2: 6sm7 C:164-296

Lineage for d6sm7c2 (6sm7 C:164-296)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [391547] (1 PDB entry)

8. Domain d6sm7c2: 6sm7 C:164-296 [391548]
   Other proteins in same PDB: d6sm7a1, d6sm7b1, d6sm7c1, d6sm7d1
   automated match to d3pdua2
   complexed with bo3

Details for d6sm7c2

PDB Entry: 6sm7, 1.88 Å

PDB Description: crystal structure of sla reductase yihu from e. coli

PDB Compounds: (C:) 3-sulfolactaldehyde reductase

SCOPe Domain Sequences for d6sm7c2:

Sequence; same for both SEQRES and ATOM records:

>d6sm7c2 a.100.1.0 (C:164-296) automated matches {Escherichia coli [TaxId: 562]}
pgmgirvklinnymsialnalsaeaavlcealnlpfdvavkvmsgtaagkghfttswpnk
vlsgdlspafmidlahkdlgialdvanqlhvpmplgaasrevysqaraagrgrqdwsail
eqvrvsagmtakv

Timeline for d6sm7c2:

• d6sm7c2 is new in SCOPe 2.07-stable
  
• d6sm7c2 appears in the current release, SCOPe 2.08