SCOPe 2.07: Domain d6slrb1: 6slr B:1-78

Lineage for d6slrb1 (6slr B:1-78)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.3: Saposin B [81806] (2 proteins)
   the alternative subunit conformation is an open four-helical bundle; helices 3 and 4 form a contiguous helix

6. Protein automated matches [279847] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [279848] (2 PDB entries)

8. Domain d6slrb1: 6slr B:1-78 [391525]
   Other proteins in same PDB: d6slra2, d6slrb2, d6slrc2
   automated match to d1n69a_
   complexed with aoq, gol

Details for d6slrb1

PDB Entry: 6slr, 2.38 Å

PDB Description: structure of saposin b in complex with atovaquone

PDB Compounds: (B:) prosaposin

SCOPe Domain Sequences for d6slrb1:

Sequence; same for both SEQRES and ATOM records:

>d6slrb1 a.64.1.3 (B:1-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdvcqdciqmvtdiqtavrtnstfvqalvehvkeecdrlgpgmadicknyisqyseiaiq
mmmhmqpkeicalvgfcd

Timeline for d6slrb1:

• d6slrb1 is new in SCOPe 2.07-stable
  
• d6slrb1 appears in the current release, SCOPe 2.08