SCOPe 2.07: Domain d6s6fa_: 6s6f A:

Lineage for d6s6fa_ (6s6f A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.0: automated matches [191476] (1 protein)
   not a true family

6. Protein automated matches [190763] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [391428] (2 PDB entries)

8. Domain d6s6fa_: 6s6f A: [391439]
   automated match to d1vgpa_
   complexed with cl, gol

Details for d6s6fa_

PDB Entry: 6s6f, 1.53 Å

PDB Description: crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in apo form.

PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d6s6fa_:

Sequence; same for both SEQRES and ATOM records:

>d6s6fa_ a.103.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
vagqtalstvgqegagltyrgydvrdlaaaaifeevaylllygelpnkqqldaylkklqg
qrdlpqalkevleripkdahpmdvmrtgasvlgtlepelsfdqqrdvadrllaafpaimt
ywyrfthegqridcnsdeptigghflallhgkkpselhvkvmnvslilyaehefnastft
arvcastlsdlyscvtgaigslrgplhgganeaamelierfsspqeataellkmlerkdk
imgfghaiykdsdprnevikgwskqladevgdkvlfavseaidktmweqkklfpnadfyh
asayhfmgiptklftpifvcsrtsgwtahvfeqrannriirpsaeytgveqrafvpleqr

Timeline for d6s6fa_:

• d6s6fa_ is new in SCOPe 2.07-stable
  
• d6s6fa_ appears in the current release, SCOPe 2.08