Lineage for d6m1ja_ (6m1j A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580683Species Pseudomonas aeruginosa [TaxId:208964] [391026] (2 PDB entries)
  8. 2580684Domain d6m1ja_: 6m1j A: [391380]
    automated match to d4baed_
    protein/DNA complex; complexed with dms, ez6, na, so4

Details for d6m1ja_

PDB Entry: 6m1j (more details), 1.7 Å

PDB Description: the dna gyrase b atp binding domain of pseudomonas aeruginosa in complex with compound 12x
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6m1ja_:

Sequence, based on SEQRES records: (download)

>d6m1ja_ d.122.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gldavrkrpgmyigdtddgtglhhmvfevvdnsidealagycseisitihtdesitvrdn
grgipvdihkeegvsaaevimtvlhaggkfddntykvsgglhgvgvsvvnalshelrlti
rrhnkvweqvyhhgvpqfplrevgetdgsgtevhfkpspetfsnihfswdilakrirels
flnsgvgillrdertgkeelfkyeg

Sequence, based on observed residues (ATOM records): (download)

>d6m1ja_ d.122.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gldavrkrpgmyigdtddgtglhhmvfevvdnsidealagycseisitihtdesitvrdn
grgipvdihvsaaevimtvlhaggkhgvgvsvvnalshelrltirrhnkvweqvyhhgvp
qfplrevgetdgsgtevhfkpspetfsnihfswdilakrirelsflnsgvgillrdertg
keelfkyeg

SCOPe Domain Coordinates for d6m1ja_:

Click to download the PDB-style file with coordinates for d6m1ja_.
(The format of our PDB-style files is described here.)

Timeline for d6m1ja_: