SCOPe 2.07: Domain d5rgcb_: 5rgc B:

Lineage for d5rgcb_ (5rgc B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (27 species)
   not a true protein

7. Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries)

8. Domain d5rgcb_: 5rgc B: [391374]
   automated match to d1goka_
   complexed with 6nt, so4

Details for d5rgcb_

PDB Entry: 5rgc, 1.39 Å

PDB Description: crystal structure of kemp eliminase hg3.7 with bound transition state analogue, 277k

PDB Compounds: (B:) Kemp Eliminase HG3

SCOPe Domain Sequences for d5rgcb_:

Sequence; same for both SEQRES and ATOM records:

>d5rgcb_ c.1.8.3 (B:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
qsidqlikargkvyfgvatdqnrlttgknaaiikadfgmvwpensmqwdatepsqgnfnf
agadylvnwaqqngkligggclvwhrhlpswvssitdkntltnvmknhittlmtrykgki
rnwdvvgeafnedgslrqtvflnvigedyipiafqtaraadpnaklyimdynldsasypk
tqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevsilmldvaga
sptdyvnvvnaclnvqscvgitvfgvadpdswrasttpllfdgnfnpkpaynaivqdlqq

Timeline for d5rgcb_:

• d5rgcb_ is new in SCOPe 2.07-stable
  
• d5rgcb_ appears in the current release, SCOPe 2.08