Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
Protein automated matches [190378] (9 species) not a true protein |
Species Human adenovirus 49 [TaxId:218120] [391234] (2 PDB entries) |
Domain d6qpne_: 6qpn E: [391279] automated match to d3exwa_ complexed with so4 |
PDB Entry: 6qpn (more details), 2.74 Å
SCOPe Domain Sequences for d6qpne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qpne_ b.21.1.0 (E:) automated matches {Human adenovirus 49 [TaxId: 218120]} endrrtlwttpdpspnckvseekdskltlvltkcgsqilasvsllvvkgkfaninnktnp gedykkfsvkllfdangklltgssldgnywnyknkdsvigspyenavpfmpnstaypkii nngtanpedkksaakktivtnvylggdaakpvattisfnketesncvysitfdfawnkty knvpfdsssltfsyiaqdae
Timeline for d6qpne_: