Lineage for d6qpne_ (6qpn E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386769Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2386770Protein automated matches [190378] (9 species)
    not a true protein
  7. 2386805Species Human adenovirus 49 [TaxId:218120] [391234] (2 PDB entries)
  8. 2386816Domain d6qpne_: 6qpn E: [391279]
    automated match to d3exwa_
    complexed with so4

Details for d6qpne_

PDB Entry: 6qpn (more details), 2.74 Å

PDB Description: adenovirus species d serotype 49 fiber-knob
PDB Compounds: (E:) Fiber

SCOPe Domain Sequences for d6qpne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qpne_ b.21.1.0 (E:) automated matches {Human adenovirus 49 [TaxId: 218120]}
endrrtlwttpdpspnckvseekdskltlvltkcgsqilasvsllvvkgkfaninnktnp
gedykkfsvkllfdangklltgssldgnywnyknkdsvigspyenavpfmpnstaypkii
nngtanpedkksaakktivtnvylggdaakpvattisfnketesncvysitfdfawnkty
knvpfdsssltfsyiaqdae

SCOPe Domain Coordinates for d6qpne_:

Click to download the PDB-style file with coordinates for d6qpne_.
(The format of our PDB-style files is described here.)

Timeline for d6qpne_: