Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Clostridium acetobutylicum [TaxId:272562] [391198] (1 PDB entry) |
Domain d6pz7a_: 6pz7 A: [391199] automated match to d4im4a_ complexed with cl, edo |
PDB Entry: 6pz7 (more details), 1.25 Å
SCOPe Domain Sequences for d6pz7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pz7a_ c.1.8.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 272562]} dmtsqqivndmkvgwnlgntldaspdetgwgnpkttkamidkikeagfntvripvswssh igagpsytidqawlnrvqevvnyviqdhmyailnthhdtswiiptynkeaastdeltkvw gqianrfkdydshlifqtlneprivgspeewnggtaesrdvinkfnltavntirstgsnn ssrfimvptyaastataamndlvipnndkrvivslhmyapysfamdpkgtshwggeadkd aldgqlnaiynkfvkngqpvvigqfgsinknnessraslakfyvsdarkkgittvwwdng ksavgddnygildrnnltwvfpklvrtivn
Timeline for d6pz7a_: