Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [391060] (3 PDB entries) |
Domain d6m2mb_: 6m2m B: [391099] automated match to d5gt0d_ complexed with gol |
PDB Entry: 6m2m (more details), 2.85 Å
SCOPe Domain Sequences for d6m2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m2mb_ a.22.1.1 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]} etykiyifkvlkqvhpdigisskamgimnsfindifeklaqessklarynkkptitsrei qtavrlvlpgelakhavsegtkavtk
Timeline for d6m2mb_: