SCOPe 2.07: Domain d6lxqa1: 6lxq A:5-186

Lineage for d6lxqa1 (6lxq A:5-186)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.0: automated matches [191372] (1 protein)
   not a true family

6. Protein automated matches [190450] (6 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [390993] (4 PDB entries)

8. Domain d6lxqa1: 6lxq A:5-186 [391017]
   Other proteins in same PDB: d6lxqa2
   automated match to d1z81a1
   complexed with gol, po4

Details for d6lxqa1

PDB Entry: 6lxq, 1.85 Å

PDB Description: tvcyp2 in apo form 3

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d6lxqa1:

Sequence; same for both SEQRES and ATOM records:

>d6lxqa1 b.62.1.0 (A:5-186) automated matches {Trichomonas vaginalis [TaxId: 5722]}
fatrvisapkvtkkvffkisingedagtikfglfgddvpktaenfralctgekgmgklgk
plhykgspfhrvipnfmiqggditsgngyggesiygskfadesfkithdgpgllsmansg
pntngsqffittvpcpwlngkhvvfgkviegmeivkkieslgsqsgtpkakiiiadcgei
te

Timeline for d6lxqa1:

• d6lxqa1 is new in SCOPe 2.07-stable
  
• d6lxqa1 appears in the current release, SCOPe 2.08