Lineage for d4lxvf_ (4lxv F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645811Domain d4lxvf_: 4lxv F: [391005]
    Other proteins in same PDB: d4lxva1, d4lxva2, d4lxvc1, d4lxvc2, d4lxve1, d4lxve2, d4lxvg1, d4lxvg2, d4lxvi1, d4lxvi2, d4lxvk1, d4lxvk2
    automated match to d3m5jb_
    complexed with nag

Details for d4lxvf_

PDB Entry: 4lxv (more details), 3 Å

PDB Description: crystal structure of the hemagglutinin from a h1n1pdm a/washington/5/2011 virus
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4lxvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lxvf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmnt
qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
vrnqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnree

SCOPe Domain Coordinates for d4lxvf_:

Click to download the PDB-style file with coordinates for d4lxvf_.
(The format of our PDB-style files is described here.)

Timeline for d4lxvf_: