Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
Protein Microphage migration inhibition factor (MIF) [55340] (8 species) synonym: glycosylation-inhibiting factor (GIF) |
Species Oncomelania hupensis [TaxId:56141] [390952] (1 PDB entry) |
Domain d6lr3g_: 6lr3 G: [390954] automated match to d1uiza_ complexed with so4 |
PDB Entry: 6lr3 (more details), 1.77 Å
SCOPe Domain Sequences for d6lr3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lr3g_ d.80.1.3 (G:) Microphage migration inhibition factor (MIF) {Oncomelania hupensis [TaxId: 56141]} pvitvntnvaeksipvffqaaltnmmtkalqkpkevmfvdlrsganimmggdrnpcvfat vecigrlnptsnlamardmedmfiehlnvrrerivirfipvpalfcsfngalhdvsi
Timeline for d6lr3g_: