SCOPe 2.07: Domain d6lbqc_: 6lbq C:

Lineage for d6lbqc_ (6lbq C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (25 species)
   not a true protein

7. Species Echovirus e11 [TaxId:12078] [390813] (10 PDB entries)

8. Domain d6lbqc_: 6lbq C: [390881]
   Other proteins in same PDB: d6lbqa_
   automated match to d1h8tc_

Details for d6lbqc_

PDB Entry: 6lbq, 2.6 Å

PDB Description: cryo-em structure of echovirus 11 empty particle at ph 5.5

PDB Compounds: (C:) capsid protein vp3

SCOPe Domain Sequences for d6lbqc_:

Sequence, based on SEQRES records:

>d6lbqc_ b.121.4.1 (C:) automated matches {Echovirus e11 [TaxId: 12078]}
glpvmntpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnveg
kldtmeiyripvqsgnhqssqvfgfqvqpgldnvfkhtllgeilnyyahwsgsikltfvf
cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqthyrlvq
qdeytsagnvtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfi

Sequence, based on observed residues (ATOM records):

>d6lbqc_ b.121.4.1 (C:) automated matches {Echovirus e11 [TaxId: 12078]}
glpvmntpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnveg
kldtmeiyripvqsgnhqssqvfgfqvqpgldnvfkhtllgeilnyyahwsgsikltfvf
cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqtytsagn
vtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfi

Timeline for d6lbqc_:

• d6lbqc_ is new in SCOPe 2.07-stable
  
• d6lbqc_ appears in the current release, SCOPe 2.08