Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:373153] [390713] (5 PDB entries) |
Domain d6l2zb2: 6l2z B:184-326 [390779] Other proteins in same PDB: d6l2za1, d6l2zb1 automated match to d4kqxb2 complexed with gol, nap, nh4, so4 |
PDB Entry: 6l2z (more details), 2.02 Å
SCOPe Domain Sequences for d6l2zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l2zb2 a.100.1.0 (B:184-326) automated matches {Streptococcus pneumoniae [TaxId: 373153]} ykeeteeglfgeqavlcggltalieagfevlteagyapelayfevlhemklivdliyegg fkkmrqsisntaeygdyvsgprviteqvkenmkavladiqngkfandfvndykagrpklt ayreqaanleiekvgaelrkamp
Timeline for d6l2zb2: