SCOPe 2.07: Domain d6l2zb2: 6l2z B:184-326

Lineage for d6l2zb2 (6l2z B:184-326)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:373153] [390713] (5 PDB entries)

8. Domain d6l2zb2: 6l2z B:184-326 [390779]
   Other proteins in same PDB: d6l2za1, d6l2zb1
   automated match to d4kqxb2
   complexed with gol, nap, nh4, so4

Details for d6l2zb2

PDB Entry: 6l2z, 2.02 Å

PDB Description: ilvc, a ketol-acid reductoisomerase, from streptococcus pnuemoniae_d191g

PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6l2zb2:

Sequence; same for both SEQRES and ATOM records:

>d6l2zb2 a.100.1.0 (B:184-326) automated matches {Streptococcus pneumoniae [TaxId: 373153]}
ykeeteeglfgeqavlcggltalieagfevlteagyapelayfevlhemklivdliyegg
fkkmrqsisntaeygdyvsgprviteqvkenmkavladiqngkfandfvndykagrpklt
ayreqaanleiekvgaelrkamp

Timeline for d6l2zb2:

• d6l2zb2 is new in SCOPe 2.07-stable
  
• d6l2zb2 appears in the current release, SCOPe 2.08