Lineage for d6kyjy_ (6kyj Y:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564681Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2564682Protein automated matches [336552] (9 species)
    not a true protein
  7. 2564709Species Sorghum bicolor [TaxId:4558] [390646] (1 PDB entry)
  8. 2564713Domain d6kyjy_: 6kyj Y: [390665]
    Other proteins in same PDB: d6kyja1, d6kyja2, d6kyjc1, d6kyjc2, d6kyje1, d6kyje2, d6kyjg1, d6kyjg2
    automated match to d1uw9c_
    complexed with gol, so4

Details for d6kyjy_

PDB Entry: 6kyj (more details), 1.7 Å

PDB Description: hybrid-rubisco (rice rbcl and sorghum rbcs) in complex with sulfate ions
PDB Compounds: (Y:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d6kyjy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kyjy_ d.73.1.0 (Y:) automated matches {Sorghum bicolor [TaxId: 4558]}
mqvwpaygnkkfetlsylpplteeqllkqvdyllrnnwvpclefskegfvyrenstspcy
ydgrywtmwklpmfgctdasqvykelqeaiasypdayvrilgfdnikqtqcvsfiaykpa

SCOPe Domain Coordinates for d6kyjy_:

Click to download the PDB-style file with coordinates for d6kyjy_.
(The format of our PDB-style files is described here.)

Timeline for d6kyjy_: