SCOPe 2.07: Domain d4kwmc1: 4kwm C:1-321

Lineage for d4kwmc1 (4kwm C:1-321)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus [TaxId:610165] [390609] (1 PDB entry)

8. Domain d4kwmc1: 4kwm C:1-321 [390614]
   Other proteins in same PDB: d4kwma2, d4kwmb_, d4kwmc2, d4kwmd_, d4kwme2, d4kwmf_
   automated match to d4d00c_
   complexed with nag

Details for d4kwmc1

PDB Entry: 4kwm, 2.7 Å

PDB Description: structure of a/anhui/5/2005 h5 ha

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4kwmc1:

Sequence; same for both SEQRES and ATOM records:

>d4kwmc1 b.19.1.0 (C:1-321) automated matches {Influenza a virus [TaxId: 610165]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheassgvssacpyqgtpsffrnvvwlikknntyptikrsynntnqedllilwgihh
sndaaeqtklyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmdffwtilkpndain
fesngnfiapeyaykivkkgdsaivkseveygncntkcqtpigainssmpfhnihpltig
ecpkyvksnklvlatglrnsp

Timeline for d4kwmc1:

• d4kwmc1 is new in SCOPe 2.07-stable
  
• d4kwmc1 appears in the current release, SCOPe 2.08