SCOPe 2.07: Domain d6knfc2: 6knf C:167-340

Lineage for d6knfc2 (6knf C:167-340)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein automated matches [226877] (4 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [274677] (3 PDB entries)

8. Domain d6knfc2: 6knf C:167-340 [390555]
   automated match to d2bw4a2
   complexed with cu

Details for d6knfc2

PDB Entry: 6knf, 2.99 Å

PDB Description: cryoem map and model of nitrite reductase at ph 6.2

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6knfc2:

Sequence; same for both SEQRES and ATOM records:

>d6knfc2 b.6.1.3 (C:167-340) automated matches {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d6knfc2:

• d6knfc2 is new in SCOPe 2.07-stable
  
• d6knfc2 appears in the current release, SCOPe 2.08