Lineage for d2at1b1 (2at1 B:8-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723615Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 723616Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 723617Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 723621Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)
  8. 723680Domain d2at1b1: 2at1 B:8-100 [39051]
    Other proteins in same PDB: d2at1a1, d2at1a2, d2at1b2, d2at1c1, d2at1c2, d2at1d2

Details for d2at1b1

PDB Entry: 2at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d2at1b1:

Click to download the PDB-style file with coordinates for d2at1b1.
(The format of our PDB-style files is described here.)

Timeline for d2at1b1: