Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (13 species) not a true protein |
Species Mus musculus polyomavirus 1 [TaxId:1891730] [390358] (1 PDB entry) |
Domain d7k25a_: 7k25 A: [390375] automated match to d1sidb_ |
PDB Entry: 7k25 (more details), 2.9 Å
SCOPe Domain Sequences for d7k25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k25a_ b.121.6.1 (A:) automated matches {Mus musculus polyomavirus 1 [TaxId: 1891730]} kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws rginlatsdtedspenntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt ktvfpg
Timeline for d7k25a_:
View in 3D Domains from other chains: (mouse over for more information) d7k25b_, d7k25c_, d7k25d_, d7k25e_ |