Lineage for d7k25a_ (7k25 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2432198Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2432199Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2432269Protein automated matches [191200] (13 species)
    not a true protein
  7. 2432563Species Mus musculus polyomavirus 1 [TaxId:1891730] [390358] (1 PDB entry)
  8. 2432564Domain d7k25a_: 7k25 A: [390375]
    automated match to d1sidb_

Details for d7k25a_

PDB Entry: 7k25 (more details), 2.9 Å

PDB Description: murine polyomavirus hexavalent capsomer, subparticle reconstruction
PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d7k25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k25a_ b.121.6.1 (A:) automated matches {Mus musculus polyomavirus 1 [TaxId: 1891730]}
kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
rginlatsdtedspenntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrfgkt
ktvfpg

SCOPe Domain Coordinates for d7k25a_:

Click to download the PDB-style file with coordinates for d7k25a_.
(The format of our PDB-style files is described here.)

Timeline for d7k25a_: