Lineage for d7k1lb2 (7k1l B:192-346)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615811Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 2615812Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 2615898Family d.294.1.0: automated matches [356574] (1 protein)
    not a true family
  6. 2615899Protein automated matches [356575] (3 species)
    not a true protein
  7. 2615906Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (6 PDB entries)
  8. 2615912Domain d7k1lb2: 7k1l B:192-346 [390371]
    Other proteins in same PDB: d7k1la1, d7k1la3, d7k1lb1, d7k1lb3
    automated match to d2h85a2
    complexed with act, edo, so4, uvc

Details for d7k1lb2

PDB Entry: 7k1l (more details), 2.25 Å

PDB Description: crystal structure of nsp15 endoribonuclease from sars cov-2 in the complex with uridine-2',3'-vanadate
PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d7k1lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k1lb2 d.294.1.0 (B:192-346) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypkl

SCOPe Domain Coordinates for d7k1lb2:

Click to download the PDB-style file with coordinates for d7k1lb2.
(The format of our PDB-style files is described here.)

Timeline for d7k1lb2: