Lineage for d6jgpa2 (6jgp A:389-602)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465847Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain-like [52279] (2 families) (S)
    automatically mapped to Pfam PF01915
  5. 2465887Family c.23.11.0: automated matches [270742] (1 protein)
    not a true family
  6. 2465888Protein automated matches [270743] (1 species)
    not a true protein
  7. 2465889Species Hordeum vulgare [TaxId:112509] [270744] (33 PDB entries)
  8. 2465911Domain d6jgpa2: 6jgp A:389-602 [390154]
    Other proteins in same PDB: d6jgpa1, d6jgpa3
    automated match to d1x38a2
    complexed with 1pe, act, gol, nag, so4; mutant

Details for d6jgpa2

PDB Entry: 6jgp (more details), 1.99 Å

PDB Description: crystal structure of barley exohydrolasei w434h mutant in complex with methyl 6-thio-beta-gentiobioside.
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo

SCOPe Domain Sequences for d6jgpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jgpa2 c.23.11.0 (A:389-602) automated matches {Hordeum vulgare [TaxId: 112509]}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiehqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat

SCOPe Domain Coordinates for d6jgpa2:

Click to download the PDB-style file with coordinates for d6jgpa2.
(The format of our PDB-style files is described here.)

Timeline for d6jgpa2: