SCOPe 2.07: Domain d7c9r8_: 7c9r 8:

Lineage for d7c9r8_ (7c9r 8:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (7 species)
   not a true protein

7. Species Thiorhodovibrio sp. [TaxId:631362] [389859] (1 PDB entry)

8. Domain d7c9r8_: 7c9r 8: [390101]
   Other proteins in same PDB: d7c9rc_, d7c9rh1, d7c9rh2, d7c9rl_, d7c9rm_
   automated match to d1wrga_
   complexed with 8k6, bcl, bph, ca, cdl, dga, fe, h4x, hem, lmt, mg, mq8, pgv, uq8

Details for d7c9r8_

PDB Entry: 7c9r, 2.82 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of thiorhodovibrio strain 970

PDB Compounds: (8:) Antenna complex alpha/beta subunit

SCOPe Domain Sequences for d7c9r8_:

Sequence; same for both SEQRES and ATOM records:

>d7c9r8_ f.3.1.0 (8:) automated matches {Thiorhodovibrio sp. [TaxId: 631362]}
sttglteaeskefhgifmasmtlwfglvvlahilswlyrpwl

Timeline for d7c9r8_:

• d7c9r8_ is new in SCOPe 2.07-stable
  
• d7c9r8_ appears in the current release, SCOPe 2.08