Lineage for d7cpla1 (7cpl A:2-351)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (27 species)
not a true protein
Species Bacillus sp. [TaxId:502601] [389994] (2 PDB entries) 
Domain d7cpla1: 7cpl A:2-351 [390052]
Other proteins in same PDB: d7cpla2
automated match to d2f8qa_
complexed with ca, mpd, ni
Details for d7cpla1
PDB Entry: 7cpl (more details), 1.52 Å
PDB Description: xylanase r from bacillus sp. tar-1
PDB Compounds: (A:) Endo-1,4-beta-xylanase ASCOPe Domain Sequences for d7cpla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cpla1 c.1.8.3 (A:2-351) automated matches {Bacillus sp. [TaxId: 502601]}
dqpfawqvaslseryqeqfdigaavepyqlegrqaqilkhhynslvaenamkpeslqpre
gewnwegadkivefarkhnmelrfhtlvwheqvpewffidedgnrmvdetdpdkreankq
lllermenhiktvverykddvtswdvvneviddggglresewyqitgtdyikvafetark
yggeeaklyindyntevpskrddlynlvkdlleqgvpidgvghqshiqigwpsiedtras
fekftslgldnqvteldmslygwpptgaytsyddipaellqaqadrydqlfelyeelaad
issvtfwgiadnhtwldgrareynngvgidapfvfdhnyrvkpaywriid
SCOPe Domain Coordinates for d7cpla1:
Click to download the PDB-style file with coordinates for d7cpla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7cpla1:
- d7cpla1 is new in SCOPe 2.07-stable
- d7cpla1 appears in the current release, SCOPe 2.08
View in 3D
