Lineage for d7cn7a_ (7cn7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533682Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2533683Protein automated matches [190563] (18 species)
    not a true protein
  7. 2533693Species Enterobacteria phage [TaxId:10665] [390028] (1 PDB entry)
  8. 2533694Domain d7cn7a_: 7cn7 A: [390029]
    automated match to d2qarc_
    complexed with 1pg, cl, edo, na

Details for d7cn7a_

PDB Entry: 7cn7 (more details), 1.15 Å

PDB Description: t4 phage spackle protein gp61.3 complex with lysozyme domain of gp5 tail lysozyme
PDB Compounds: (A:) Baseplate central spike complex protein gp5

SCOPe Domain Sequences for d7cn7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cn7a_ d.2.1.0 (A:) automated matches {Enterobacteria phage [TaxId: 10665]}
eiptddnpnmsmaemlrrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvlskq
vgreitgnpgsitmeeattlferdladmqrdikshskvgpvwqavnrsrqmalenmafqm
gvggvakfntmltamlagdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygve

SCOPe Domain Coordinates for d7cn7a_:

Click to download the PDB-style file with coordinates for d7cn7a_.
(The format of our PDB-style files is described here.)

Timeline for d7cn7a_: