Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Fe-only hydrogenase, second domain [54885] (1 species) |
Species Clostridium pasteurianum [TaxId:1501] [54886] (4 PDB entries) |
Domain d1c4aa3: 1c4a A:127-209 [39000] Other proteins in same PDB: d1c4aa1, d1c4aa2 complexed with fes, hc1, sf4 |
PDB Entry: 1c4a (more details), 2.4 Å
SCOPe Domain Sequences for d1c4aa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4aa3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd dtncllcgqciiacpvaalseks
Timeline for d1c4aa3: