SCOPe 2.07: Domain d7cbgb2: 7cbg B:533-640

Lineage for d7cbgb2 (7cbg B:533-640)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (6 species)
   not a true protein

7. Species Salmonella enterica [TaxId:1192560] [378975] (5 PDB entries)

8. Domain d7cbgb2: 7cbg B:533-640 [389974]
   Other proteins in same PDB: d7cbga1, d7cbga3, d7cbgb1, d7cbgb3
   automated match to d1qf6a1
   protein/RNA complex; complexed with fql, zn

Details for d7cbgb2

PDB Entry: 7cbg, 2.5 Å

PDB Description: crystal structure of threonyl-trna synthetase (thrrs) from salmonella enterica in complex with an inhibitor

PDB Compounds: (B:) Threonine--tRNA ligase

SCOPe Domain Sequences for d7cbgb2:

Sequence; same for both SEQRES and ATOM records:

>d7cbgb2 c.51.1.0 (B:533-640) automated matches {Salmonella enterica [TaxId: 1192560]}
fptwlapvqvvvmnitdsqseyvneltqklqnagirvkadlrnekigfkirehtlrrvpy
mlvcgdkeveagkvavrtrrgkdlgsldvndvieklqqeirsrslqql

Timeline for d7cbgb2:

• d7cbgb2 is new in SCOPe 2.07-stable
  
• d7cbgb2 appears in the current release, SCOPe 2.08