SCOPe 2.07: Domain d7chcl2: 7chc L:107-213

Lineage for d7chcl2 (7chc L:107-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d7chcl2: 7chc L:107-213 [389969]
   Other proteins in same PDB: d7chcb1, d7chcl1, d7chcr_
   automated match to d1dn0a2

Details for d7chcl2

PDB Entry: 7chc, 2.71 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-629 fab and bd-368-2 fab

PDB Compounds: (L:) IGK@ protein

SCOPe Domain Sequences for d7chcl2:

Sequence; same for both SEQRES and ATOM records:

>d7chcl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7chcl2:

• d7chcl2 is new in SCOPe 2.07-stable
  
• d7chcl2 appears in the current release, SCOPe 2.08