Lineage for d7ch4l1 (7ch4 L:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368554Domain d7ch4l1: 7ch4 L:1-106 [389963]
    Other proteins in same PDB: d7ch4l2, d7ch4r_
    automated match to d1dn0a1

Details for d7ch4l1

PDB Entry: 7ch4 (more details), 3.15 Å

PDB Description: crystal structure of the sars-cov-2 s rbd in complex with bd-604 fab
PDB Compounds: (L:) BD-604 Fab L

SCOPe Domain Sequences for d7ch4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ch4l1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsflsasvgdrvtitcrasqgissdlawyqqkpgkapnlliyaastlqsgvps
rfsgsgsgteftltisslqpedfatyycqqlnsdlytfgqgtklei

SCOPe Domain Coordinates for d7ch4l1:

Click to download the PDB-style file with coordinates for d7ch4l1.
(The format of our PDB-style files is described here.)

Timeline for d7ch4l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7ch4l2
View in 3D
Domains from other chains:
(mouse over for more information)
d7ch4r_