SCOPe 2.07: Domain d7cbia1: 7cbi A:242-532

Lineage for d7cbia1 (7cbi A:242-532)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein automated matches [193659] (7 species)
   not a true protein

7. Species Salmonella enterica [TaxId:1192560] [378973] (5 PDB entries)

8. Domain d7cbia1: 7cbi A:242-532 [389892]
   Other proteins in same PDB: d7cbia2, d7cbia3, d7cbib2, d7cbib3
   automated match to d1qf6a4
   protein/RNA complex; complexed with edo, fqu, gol, zn

Details for d7cbia1

PDB Entry: 7cbi, 1.59 Å

PDB Description: crystal structure of threonyl-trna synthetase (thrrs) from salmonella enterica in complex with an inhibitor

PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d7cbia1:

Sequence; same for both SEQRES and ATOM records:

>d7cbia1 d.104.1.1 (A:242-532) automated matches {Salmonella enterica [TaxId: 1192560]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgalhglmrvrgftqddahifcteeqirdevnacirmvydmystfgfekivvkls
trpdkrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d7cbia1:

• d7cbia1 is new in SCOPe 2.07-stable
  
• d7cbia1 appears in the current release, SCOPe 2.08