Lineage for d1gaod_ (1gao D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32367Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 32383Family d.58.1.2: 7-Fe ferredoxin [54870] (1 protein)
  6. 32384Protein Ferredoxin [54871] (2 species)
  7. 32385Species Azotobacter vinelandii [TaxId:354] [54872] (30 PDB entries)
  8. 32417Domain d1gaod_: 1gao D: [38980]

Details for d1gaod_

PDB Entry: 1gao (more details), 2.2 Å

PDB Description: crystal structure of the l44s mutant of ferredoxin i

SCOP Domain Sequences for d1gaod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaod_ d.58.1.2 (D:) Ferredoxin {Azotobacter vinelandii}
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcascepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler

SCOP Domain Coordinates for d1gaod_:

Click to download the PDB-style file with coordinates for d1gaod_.
(The format of our PDB-style files is described here.)

Timeline for d1gaod_: