Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Coxsackievirus a10 [TaxId:42769] [359971] (7 PDB entries) |
Domain d7bzub_: 7bzu B: [389797] Other proteins in same PDB: d7bzuc_ automated match to d4jgyb_ complexed with nag |
PDB Entry: 7bzu (more details), 3 Å
SCOPe Domain Sequences for d7bzub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bzub_ b.121.4.0 (B:) automated matches {Coxsackievirus a10 [TaxId: 42769]} sdrvaqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsvnrfytldsk mwqenstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqgallvavipe fviagrgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyphqwinlrtn ncatvivpyinavpfdsainhsnfglivipvsplkyssgattaipititiaplnsefggl rqavsq
Timeline for d7bzub_: