Lineage for d7bzub_ (7bzu B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431822Species Coxsackievirus a10 [TaxId:42769] [359971] (7 PDB entries)
  8. 2431827Domain d7bzub_: 7bzu B: [389797]
    Other proteins in same PDB: d7bzuc_
    automated match to d4jgyb_
    complexed with nag

Details for d7bzub_

PDB Entry: 7bzu (more details), 3 Å

PDB Description: cryo-em structure of mature coxsackievirus a10 in complex with krm1 at ph 5.5
PDB Compounds: (B:) capsid protein VP2

SCOPe Domain Sequences for d7bzub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bzub_ b.121.4.0 (B:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
sdrvaqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsvnrfytldsk
mwqenstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqgallvavipe
fviagrgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyphqwinlrtn
ncatvivpyinavpfdsainhsnfglivipvsplkyssgattaipititiaplnsefggl
rqavsq

SCOPe Domain Coordinates for d7bzub_:

Click to download the PDB-style file with coordinates for d7bzub_.
(The format of our PDB-style files is described here.)

Timeline for d7bzub_: