Lineage for d7bv6n_ (7bv6 N:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644809Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2644927Family h.1.15.0: automated matches [254266] (1 protein)
    not a true family
  6. 2644928Protein automated matches [254614] (3 species)
    not a true protein
  7. 2644929Species Human (Homo sapiens) [TaxId:9606] [270047] (2 PDB entries)
  8. 2644939Domain d7bv6n_: 7bv6 N: [389767]
    automated match to d4wy4b_

Details for d7bv6n_

PDB Entry: 7bv6 (more details), 3.05 Å

PDB Description: crystal structure of the autophagic stx17/snap29/vamp8 snare complex
PDB Compounds: (N:) Syntaxin-17

SCOPe Domain Sequences for d7bv6n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bv6n_ h.1.15.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaeswetleadlielsqlvtdfsllvnsqqekidsiadhvnsaavnveegtknlgkaaky

SCOPe Domain Coordinates for d7bv6n_:

Click to download the PDB-style file with coordinates for d7bv6n_.
(The format of our PDB-style files is described here.)

Timeline for d7bv6n_: