Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.0: automated matches [254266] (1 protein) not a true family |
Protein automated matches [254614] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [270047] (2 PDB entries) |
Domain d7bv6n_: 7bv6 N: [389767] automated match to d4wy4b_ |
PDB Entry: 7bv6 (more details), 3.05 Å
SCOPe Domain Sequences for d7bv6n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bv6n_ h.1.15.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aaeswetleadlielsqlvtdfsllvnsqqekidsiadhvnsaavnveegtknlgkaaky
Timeline for d7bv6n_: