Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Azospirillum brasilense [TaxId:192] [225809] (5 PDB entries) |
Domain d7c0dc_: 7c0d C: [389731] automated match to d3fkka_ complexed with kyq |
PDB Entry: 7c0d (more details), 1.6 Å
SCOPe Domain Sequences for d7c0dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c0dc_ c.1.10.0 (C:) automated matches {Azospirillum brasilense [TaxId: 192]} tprhrgifpvvpttfadtgeldlasqkravdfmidagsdglcilanfseqfaitdderdv ltrtilehvagrvpvivttshystqvcaarslraqqlgaamvmamppyhgatfrvpeaqi fefyarvsdaiaipimvqdapasgtalsapflarmareieqvayfkietpgaanklreli rlggdaiegpwdgeeaitlladlhagatgamtgggfpdgirpileawregrhddayaryq awlplinhenrqsgiltakalmreggviaserprhpmpelhpdtraellaiarrldplvl rwa
Timeline for d7c0dc_: