SCOPe 2.07: Domain d7bura2: 7bur A:235-388

Lineage for d7bura2 (7bur A:235-388)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein automated matches [226868] (6 species)
   not a true protein

7. Species Glycine max [TaxId:3847] [389663] (2 PDB entries)

8. Domain d7bura2: 7bur A:235-388 [389715]
   Other proteins in same PDB: d7burb3
   automated match to d1bi5a2
   complexed with cit, csd, nar

Details for d7bura2

PDB Entry: 7bur, 1.82 Å

PDB Description: chalcone synthase from glycine max (l.) merr (soybean) complexed with naringenin

PDB Compounds: (A:) Chalcone synthase 1

SCOPe Domain Sequences for d7bura2:

Sequence; same for both SEQRES and ATOM records:

>d7bura2 c.95.1.2 (A:235-388) automated matches {Glycine max [TaxId: 3847]}
lfqlvwtaqtilpdsegaidghlrevgltfhllkdvpgliskniekalveafqplgisdy
nsifwiahpggpaildqveaklglkpekmeatrhvlseygnmssacvlfildqmrkksie
nglgttgegldwgvlfgfgpgltvetvvlrsvtl

Timeline for d7bura2:

• d7bura2 is new in SCOPe 2.07-stable
  
• d7bura2 appears in the current release, SCOPe 2.08