Lineage for d7agfc_ (7agf C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386578Species Human adenovirus b serotype 7 [TaxId:10519] [389642] (1 PDB entry)
  8. 2386581Domain d7agfc_: 7agf C: [389643]
    automated match to d3exva_

Details for d7agfc_

PDB Entry: 7agf (more details), 3.1 Å

PDB Description: had7 knob in complex with 3 ec2-ec3 modules of dsg-2
PDB Compounds: (C:) Fiber

SCOPe Domain Sequences for d7agfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7agfc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus b serotype 7 [TaxId: 10519]}
ddnintlwtgvnpttancqimassesndckliltlvktgalvtafvyvigvsndfnmltt
hkninftaelffdstgnlltslsslktplnhksgqnmatgaltnakgfmpsttaypfnvn
srekenyiygtcyytasdhtafpidisvmlnqralnnetsycirvtwswntgvapevqts
attlvtspftfyyiredd

SCOPe Domain Coordinates for d7agfc_:

Click to download the PDB-style file with coordinates for d7agfc_.
(The format of our PDB-style files is described here.)

Timeline for d7agfc_: