Lineage for d6m3xm_ (6m3x M:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556875Family d.58.4.17: SOR-like [143278] (2 proteins)
    Pfam PF07682; duplication: consists of two similar domains
  6. 2556879Protein automated matches [190550] (3 species)
    not a true protein
  7. 2556938Species Sulfurisphaera tokodaii [TaxId:273063] [389262] (2 PDB entries)
  8. 2556959Domain d6m3xm_: 6m3x M: [389601]
    automated match to d3bxva_
    complexed with fe

Details for d6m3xm_

PDB Entry: 6m3x (more details), 2.24 Å

PDB Description: cryo-em structure of sulfur oxygenase reductase from sulfurisphaera tokodaii
PDB Compounds: (M:) Sulfur oxygenase/reductase

SCOPe Domain Sequences for d6m3xm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m3xm_ d.58.4.17 (M:) automated matches {Sulfurisphaera tokodaii [TaxId: 273063]}
pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga
kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy
anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai
ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef
rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty
wreylneyhl

SCOPe Domain Coordinates for d6m3xm_:

Click to download the PDB-style file with coordinates for d6m3xm_.
(The format of our PDB-style files is described here.)

Timeline for d6m3xm_: