SCOPe 2.07: Domain d6xfsb_: 6xfs B:

Lineage for d6xfsb_ (6xfs B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225496] (22 PDB entries)

8. Domain d6xfsb_: 6xfs B: [389578]
   automated match to d5evla_
   complexed with edo, peg, pge, tbe

Details for d6xfsb_

PDB Entry: 6xfs, 2.7 Å

PDB Description: class c beta-lactamase from escherichia coli in complex with tazobactam

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6xfsb_:

Sequence; same for both SEQRES and ATOM records:

>d6xfsb_ e.3.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk
lnhtwinvpsaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiingsdnkialaarpvkpitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

Timeline for d6xfsb_:

• d6xfsb_ is new in SCOPe 2.07-stable
  
• d6xfsb_ appears in the current release, SCOPe 2.08