Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Escherichia coli [TaxId:562] [225496] (22 PDB entries) |
Domain d6xfsb_: 6xfs B: [389578] automated match to d5evla_ complexed with edo, peg, pge, tbe |
PDB Entry: 6xfs (more details), 2.7 Å
SCOPe Domain Sequences for d6xfsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xfsb_ e.3.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamktrvfqplk lnhtwinvpsaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiiingsdnkialaarpvkpitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq
Timeline for d6xfsb_: