SCOPe 2.07: Domain d6vs9a_: 6vs9 A:

Lineage for d6vs9a_ (6vs9 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:419947] [370794] (5 PDB entries)

8. Domain d6vs9a_: 6vs9 A: [389513]
   automated match to d1df7a_
   complexed with co, gol, nap, po4, rk4, so4

Details for d6vs9a_

PDB Entry: 6vs9, 1.84 Å

PDB Description: mycobacterium tuberculosis dihydrofolate reductase in complex with 3- (piperidin-1-ylmethyl)benzoic acid(fragment 11)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6vs9a_:

Sequence; same for both SEQRES and ATOM records:

>d6vs9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 419947]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d6vs9a_:

• d6vs9a_ is new in SCOPe 2.07-stable
  
• d6vs9a_ appears in the current release, SCOPe 2.08