SCOPe 2.07: Domain d6txra1: 6txr A:3-150

Lineage for d6txra1 (6txr A:3-150)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [389426] (1 PDB entry)

8. Domain d6txra1: 6txr A:3-150 [389432]
   Other proteins in same PDB: d6txra2, d6txrb2, d6txrc2, d6txrd2
   automated match to d2a92a1
   complexed with da, dc, dg, du, o0q

Details for d6txra1

PDB Entry: 6txr, 2.5 Å

PDB Description: structural insights into cubane-modified aptamer recognition of a malaria biomarker

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6txra1:

Sequence, based on SEQRES records:

>d6txra1 c.2.1.5 (A:3-150) automated matches {Plasmodium vivax [TaxId: 5855]}
pkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvt
gsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnafi
ivvtnpvdvmvqllfehsgvpknkiigl

Sequence, based on observed residues (ATOM records):

>d6txra1 c.2.1.5 (A:3-150) automated matches {Plasmodium vivax [TaxId: 5855]}
pkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvt
gsnsyddlkgadvvivtagftkanrddllplnnkimieigghiknlcpnafiivvtnpvd
vmvqllfehsgvpknkiigl

Timeline for d6txra1:

• d6txra1 is new in SCOPe 2.07-stable
  
• d6txra1 appears in the current release, SCOPe 2.08