Lineage for d6l50e_ (6l50 E:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643668Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2643669Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2643682Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2643683Protein automated matches [324386] (3 species)
    not a true protein
  7. 2643694Species Zika virus [TaxId:64320] [327137] (14 PDB entries)
  8. 2643713Domain d6l50e_: 6l50 E: [389247]
    Other proteins in same PDB: d6l50b_, d6l50d_, d6l50f_, d6l50h_
    automated match to d2ggva_
    complexed with e60

Details for d6l50e_

PDB Entry: 6l50 (more details), 1.95 Å

PDB Description: crystal structure of zika ns2b-ns3 protease with compound 16
PDB Compounds: (E:) Serine protease subunit NS2B

SCOPe Domain Sequences for d6l50e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l50e_ g.96.1.0 (E:) automated matches {Zika virus [TaxId: 64320]}
myieragditwekdaevtgnsprldvaldesgdfslv

SCOPe Domain Coordinates for d6l50e_:

Click to download the PDB-style file with coordinates for d6l50e_.
(The format of our PDB-style files is described here.)

Timeline for d6l50e_: