SCOPe 2.08: Domain d6w0gb2: 6w0g B:108-212

Lineage for d6w0gb2 (6w0g B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries)

8. Domain d6w0gb2: 6w0g B:108-212 [389178]
   Other proteins in same PDB: d6w0ga1, d6w0ga2, d6w0gb1, d6w0gc_
   automated match to d1r3ja2
   complexed with k

Details for d6w0gb2

PDB Entry: 6w0g, 2.6 Å

PDB Description: closed-gate kcsa soaked in 1mm kcl/5mm bacl2

PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d6w0gb2:

Sequence; same for both SEQRES and ATOM records:

>d6w0gb2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6w0gb2:

• d6w0gb2 first appeared in SCOPe 2.07