Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (7 species) not a true protein |
Species New jersey polyomavirus-2013 [TaxId:1497391] [389096] (2 PDB entries) |
Domain d6y5xi_: 6y5x I: [389129] automated match to d1vpsb_ complexed with gol, mg |
PDB Entry: 6y5x (more details), 2.3 Å
SCOPe Domain Sequences for d6y5xi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y5xi_ b.121.6.0 (I:) automated matches {New jersey polyomavirus-2013 [TaxId: 1497391]} atteielwleprmgvnaptgdrkewygysevihhadgydnnllsvqmpqyscarvqlpml ntdmtcetlmmweavscktevvgigslisvhlleakmeagpnsdgpsrpiegmnyhmfav ggepldlqgiesngqtkyataipaksihpndiaklpeedkaqlqglvpkakakldkdgfy pveewspdpsrnensryygsfvgglqtppnlqftnavstvlldengvgplckgdglfvsc adicgvlvkadneairyrglpryfkvtlrkravk
Timeline for d6y5xi_: