Lineage for d6y5xi_ (6y5x I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2432198Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2432636Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2432637Protein automated matches [226836] (7 species)
    not a true protein
  7. 2432686Species New jersey polyomavirus-2013 [TaxId:1497391] [389096] (2 PDB entries)
  8. 2432705Domain d6y5xi_: 6y5x I: [389129]
    automated match to d1vpsb_
    complexed with gol, mg

Details for d6y5xi_

PDB Entry: 6y5x (more details), 2.3 Å

PDB Description: structure of apo new jersey polyomavirus vp1
PDB Compounds: (I:) vp1

SCOPe Domain Sequences for d6y5xi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y5xi_ b.121.6.0 (I:) automated matches {New jersey polyomavirus-2013 [TaxId: 1497391]}
atteielwleprmgvnaptgdrkewygysevihhadgydnnllsvqmpqyscarvqlpml
ntdmtcetlmmweavscktevvgigslisvhlleakmeagpnsdgpsrpiegmnyhmfav
ggepldlqgiesngqtkyataipaksihpndiaklpeedkaqlqglvpkakakldkdgfy
pveewspdpsrnensryygsfvgglqtppnlqftnavstvlldengvgplckgdglfvsc
adicgvlvkadneairyrglpryfkvtlrkravk

SCOPe Domain Coordinates for d6y5xi_:

Click to download the PDB-style file with coordinates for d6y5xi_.
(The format of our PDB-style files is described here.)

Timeline for d6y5xi_: