SCOPe 2.08: Domain d6w0hc_: 6w0h C:

Lineage for d6w0hc_ (6w0h C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)

8. Domain d6w0hc_: 6w0h C: [389122]
   Other proteins in same PDB: d6w0ha1, d6w0ha2, d6w0hb1, d6w0hb2
   automated match to d1r3jc_
   complexed with k

Details for d6w0hc_

PDB Entry: 6w0h, 2.6 Å

PDB Description: closed-gate kcsa soaked in 5mm kcl/5mm bacl2

PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d6w0hc_:

Sequence; same for both SEQRES and ATOM records:

>d6w0hc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d6w0hc_:

• d6w0hc_ first appeared in SCOPe 2.07