Lineage for d6tj8b2 (6tj8 B:333-527)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865279Species Escherichia coli [TaxId:83333] [324640] (4 PDB entries)
  8. 2865281Domain d6tj8b2: 6tj8 B:333-527 [389047]
    Other proteins in same PDB: d6tj8a1, d6tj8a3, d6tj8a4, d6tj8b1, d6tj8b3, d6tj8b4
    automated match to d1qgda1
    complexed with ca, edo, ndq

Details for d6tj8b2

PDB Entry: 6tj8 (more details), 0.92 Å

PDB Description: escherichia coli transketolase in complex with cofactor analog 2'- methoxythiamine diphosphate
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d6tj8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tj8b2 c.36.1.0 (B:333-527) automated matches {Escherichia coli [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe

SCOPe Domain Coordinates for d6tj8b2:

Click to download the PDB-style file with coordinates for d6tj8b2.
(The format of our PDB-style files is described here.)

Timeline for d6tj8b2: