Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267767] (8 PDB entries) |
Domain d6vbza_: 6vbz A: [389039] automated match to d5h3qa_ complexed with mn |
PDB Entry: 6vbz (more details), 2.19 Å
SCOPe Domain Sequences for d6vbza_:
Sequence, based on SEQRES records: (download)
>d6vbza_ d.144.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} vkeipkedlgypwtklktnklstiyrgeyykspvtikvfnnpkaesvgivrltfneeikt mkkfdspnilrifgicidqtvkppefsivmeycelgtlrelldrdkdltmsvrsllvlra arglyrlhhsgtlhgnissssflvaggyqvklagfelsktqtsisratkstkaerfssta yvsperlqdpfckydtkaeiysfgivlweiatgkipfegcdsekiyelvaenkkqepvgq dcpellqeiinecrahepsnrpsadgilerlp
>d6vbza_ d.144.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} vkeipkedlgypwtklktnklstiyrgeyykspvtikvfnnpkaesvgivrltfneeikt mkkfdspnilrifgicidqtvkppefsivmeycelgtlrelldrdkdltmsvrsllvlra arglyrlhhsgtlhgnissssflvaggyqvklagfelsrfsstayvsperlqdpfckydt kaeiysfgivlweiatgkipfegcdsekiyelvaenkkqepvgqdcpellqeiinecrah epsnrpsadgilerlp
Timeline for d6vbza_: