Lineage for d1bxea_ (1bxe A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191859Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
  4. 191860Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
  5. 191861Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 191862Protein Ribosomal protein L22 [54845] (2 species)
  7. 191871Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (1 PDB entry)
  8. 191872Domain d1bxea_: 1bxe A: [38898]

Details for d1bxea_

PDB Entry: 1bxe (more details), 1.9 Å

PDB Description: ribosomal protein l22 from thermus thermophilus

SCOP Domain Sequences for d1bxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxea_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus}
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOP Domain Coordinates for d1bxea_:

Click to download the PDB-style file with coordinates for d1bxea_.
(The format of our PDB-style files is described here.)

Timeline for d1bxea_: