Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.0: automated matches [191477] (1 protein) not a true family |
Protein automated matches [190764] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187978] (13 PDB entries) |
Domain d6ktrd_: 6ktr D: [388976] Other proteins in same PDB: d6ktrb1, d6ktrb2, d6ktrg1, d6ktrg2 automated match to d2p39a_ complexed with na, so4 |
PDB Entry: 6ktr (more details), 2.6 Å
SCOPe Domain Sequences for d6ktrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ktrd_ b.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gwgdpirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvh svrylcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqlykn rgflplshflpmlpmv
Timeline for d6ktrd_: