Lineage for d6ktrd_ (6ktr D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401634Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2401635Protein automated matches [190764] (2 species)
    not a true protein
  7. 2401643Species Human (Homo sapiens) [TaxId:9606] [187978] (13 PDB entries)
  8. 2401659Domain d6ktrd_: 6ktr D: [388976]
    Other proteins in same PDB: d6ktrb1, d6ktrb2, d6ktrg1, d6ktrg2
    automated match to d2p39a_
    complexed with na, so4

Details for d6ktrd_

PDB Entry: 6ktr (more details), 2.6 Å

PDB Description: crystal structure of fibroblast growth factor 19 in complex with fab
PDB Compounds: (D:) Fibroblast growth factor 19

SCOPe Domain Sequences for d6ktrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ktrd_ b.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwgdpirlrhlytsgphglsscflriradgvvdcargqsahslleikavalrtvaikgvh
svrylcmgadgkmqgllqyseedcafeeeirpdgynvyrsekhrlpvslssakqrqlykn
rgflplshflpmlpmv

SCOPe Domain Coordinates for d6ktrd_:

Click to download the PDB-style file with coordinates for d6ktrd_.
(The format of our PDB-style files is described here.)

Timeline for d6ktrd_: