Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [388929] (1 PDB entry) |
Domain d6pnzc1: 6pnz C:1-143 [388944] automated match to d3r7fa1 complexed with pal |
PDB Entry: 6pnz (more details), 2.27 Å
SCOPe Domain Sequences for d6pnzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pnzc1 c.78.1.0 (C:1-143) automated matches {Staphylococcus aureus [TaxId: 93062]} mnhllsmehlstdqiykliqkasqfksgerqlpnfegkyvanlffenstrtkcsfemael klglktisfetstssvskgeslydtcktlesigcdllvirhpfnnyyeklaninipiana gdgsgqhptqslldlmtiyeeyg
Timeline for d6pnzc1:
View in 3D Domains from other chains: (mouse over for more information) d6pnza1, d6pnza2, d6pnzb1, d6pnzb2 |