Lineage for d6pnzc1 (6pnz C:1-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514587Species Staphylococcus aureus [TaxId:93062] [388929] (1 PDB entry)
  8. 2514592Domain d6pnzc1: 6pnz C:1-143 [388944]
    automated match to d3r7fa1
    complexed with pal

Details for d6pnzc1

PDB Entry: 6pnz (more details), 2.27 Å

PDB Description: the structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.
PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d6pnzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pnzc1 c.78.1.0 (C:1-143) automated matches {Staphylococcus aureus [TaxId: 93062]}
mnhllsmehlstdqiykliqkasqfksgerqlpnfegkyvanlffenstrtkcsfemael
klglktisfetstssvskgeslydtcktlesigcdllvirhpfnnyyeklaninipiana
gdgsgqhptqslldlmtiyeeyg

SCOPe Domain Coordinates for d6pnzc1:

Click to download the PDB-style file with coordinates for d6pnzc1.
(The format of our PDB-style files is described here.)

Timeline for d6pnzc1: