Lineage for d6keub_ (6keu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509622Species Erythrobacter longus [TaxId:1044] [388858] (4 PDB entries)
  8. 2509628Domain d6keub_: 6keu B: [388876]
    automated match to d5mifa_
    complexed with 6na, d8f, edo, gol, so4

Details for d6keub_

PDB Entry: 6keu (more details), 1.99 Å

PDB Description: wildtype e53, a microbial hsl esterase
PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d6keub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6keub_ c.69.1.0 (B:) automated matches {Erythrobacter longus [TaxId: 1044]}
tpfirpdmkafleaiaamagptlaemtleearasyvalhgmadrparelavirnlscpgp
agdiplrlydaresreagpvitfyhgggfvigdldthhnlcteiaalmdlpvvavdyrla
pehpfpaaiedceaatrwvasspselgrtasgvipigdsaggnativvsqllgakpadvp
vvlqvpifplasdavgsasleafaegfvltkasieffdtaykadradprgfpilgdhtaa
pptivatasldpirdsgrdyakalveagrdvvylemegvthsftniraavpstqgdleri
iaamkmmlg

SCOPe Domain Coordinates for d6keub_:

Click to download the PDB-style file with coordinates for d6keub_.
(The format of our PDB-style files is described here.)

Timeline for d6keub_: