Lineage for d6za6a_ (6za6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604588Fold d.161: ADC synthase [56321] (1 superfamily)
    duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets
  4. 2604589Superfamily d.161.1: ADC synthase [56322] (2 families) (S)
    the active site is formed by additional structures inserted into the core structure
  5. 2604590Family d.161.1.1: ADC synthase [56323] (6 proteins)
  6. 2604653Protein automated matches [190419] (2 species)
    not a true protein
  7. 2604657Species Mycobacterium tuberculosis [TaxId:83332] [388780] (3 PDB entries)
  8. 2604658Domain d6za6a_: 6za6 A: [388820]
    automated match to d3st6a_
    complexed with ba, cl, gol, po4

Details for d6za6a_

PDB Entry: 6za6 (more details), 1.8 Å

PDB Description: m. tuberculosis salicylate synthase mbti in complex with ba2+
PDB Compounds: (A:) Salicylate synthase

SCOPe Domain Sequences for d6za6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6za6a_ d.161.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi
rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv
fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava
vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv
tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae
pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai
frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee
tceklstltpylvar

SCOPe Domain Coordinates for d6za6a_:

Click to download the PDB-style file with coordinates for d6za6a_.
(The format of our PDB-style files is described here.)

Timeline for d6za6a_: