Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.161: ADC synthase [56321] (1 superfamily) duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets |
Superfamily d.161.1: ADC synthase [56322] (2 families) the active site is formed by additional structures inserted into the core structure |
Family d.161.1.1: ADC synthase [56323] (6 proteins) |
Protein automated matches [190419] (2 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [388780] (3 PDB entries) |
Domain d6za6a_: 6za6 A: [388820] automated match to d3st6a_ complexed with ba, cl, gol, po4 |
PDB Entry: 6za6 (more details), 1.8 Å
SCOPe Domain Sequences for d6za6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6za6a_ d.161.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee tceklstltpylvar
Timeline for d6za6a_: